PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00024.48
Common NameAMTR_s00024p00094630, LOC18439236
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family HD-ZIP
Protein Properties Length: 702aa    MW: 76935.2 Da    PI: 6.6534
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00024.48genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.19.6e-211873156
                                             TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                                 Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                                             +++ +++t++q++eLe++F++n++p++++r +L++ l+L+ rq+k+WFqNrR+++k
  evm_27.model.AmTr_v1.0_scaffold00024.48 18 KKRYHRHTAHQIQELEAMFKENPHPDEKQRLQLSRDLSLEPRQIKFWFQNRRTQMK 73
                                             688999***********************************************998 PP

2START186.91.1e-582154373206
                                              HHHHHHHHHHHHHHC-TT-EEEE.......EXCCTTEEEEEEESSS...SCEEEEEEEECCSCHHHHHHH CS
                                    START   3 aeeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv..dsgealrasgvvdmvlallve 63 
                                              a  a++e++++++aee +W+k s         +n++ v  +++++k+   ++ea+r+sg+v+m+ + l  
  evm_27.model.AmTr_v1.0_scaffold00024.48 215 ATNAMDEFLRLVQAEERLWMKTSpeagevlNLDNYERVFARPSQGKNpdLRTEASRDSGLVIMNGVALID 284
                                              6789*******************9**9999999999999***99999*******************9999 PP

                                              HHCCCGGCT-TT-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS- CS
                                    START  64 ellddkeqWdetla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagd 122
                                               l+d + +W e+++    +a ++ev+s+g      g lqlm aelq+lsplv+ R+f+f+Ry++ +g g+
  evm_27.model.AmTr_v1.0_scaffold00024.48 285 MLVDPN-KWMEMFPtiisRARIIEVLSPGlpgnrsGSLQLMHAELQVLSPLVStREFYFLRYCQHHGPGS 353
                                              999999.*************************************************************** PP

                                              EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXX.HHHHHHHHHHHHHH CS
                                    START 123 wvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlp.hwllrslvksglae 191
                                              w++vdvSvds ++ +   s+  ++++pSg+li++++ng+skvtwvehv+ +++ p h ++r+l++sg+a+
  evm_27.model.AmTr_v1.0_scaffold00024.48 354 WAVVDVSVDSARETQ-FNSLLQCRKFPSGCLIQDMPNGYSKVTWVEHVEIEDKNPtHRIYRQLIHSGMAF 422
                                              *************99.8***************************************************** PP

                                              HHHHHHHHTXXXXXX CS
                                    START 192 gaktwvatlqrqcek 206
                                              ga +w+a lqr ce+
  evm_27.model.AmTr_v1.0_scaffold00024.48 423 GAHRWLASLQRMCER 437
                                              *************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.7E-23369IPR009057Homeodomain-like
SuperFamilySSF466898.77E-21675IPR009057Homeodomain-like
PROSITE profilePS5007118.3661575IPR001356Homeobox domain
SMARTSM003897.8E-191679IPR001356Homeobox domain
CDDcd000861.75E-181876No hitNo description
PfamPF000463.0E-181873IPR001356Homeobox domain
PROSITE patternPS0002705073IPR017970Homeobox, conserved site
PROSITE profilePS5084850.675204440IPR002913START domain
SuperFamilySSF559613.3E-37206439No hitNo description
CDDcd088752.85E-121208436No hitNo description
SMARTSM002341.7E-46213437IPR002913START domain
PfamPF018521.3E-50215437IPR002913START domain
Gene3DG3DSA:3.30.530.202.5E-9266437IPR023393START-like domain
SuperFamilySSF559612.53E-24457693No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 702 aa     Download sequence    Send to blast
MEGGSGDDQD ASDPQRKKKR YHRHTAHQIQ ELEAMFKENP HPDEKQRLQL SRDLSLEPRQ  60
IKFWFQNRRT QMKAQHERAD NCALRAENDK IRCENIAIRE ALKNVICPSC GGPPVGDDYF  120
DEQKLRLENA RLKEELDRIS SITAKYMGRP IPQLPPVQPV TMSALDLTVG NFGGQGIGPS  180
LDLDLLPGSS SLAGLPLSSG GGVAELEKSI MVDLATNAMD EFLRLVQAEE RLWMKTSPEA  240
GEVLNLDNYE RVFARPSQGK NPDLRTEASR DSGLVIMNGV ALIDMLVDPN KWMEMFPTII  300
SRARIIEVLS PGLPGNRSGS LQLMHAELQV LSPLVSTREF YFLRYCQHHG PGSWAVVDVS  360
VDSARETQFN SLLQCRKFPS GCLIQDMPNG YSKVTWVEHV EIEDKNPTHR IYRQLIHSGM  420
AFGAHRWLAS LQRMCERVAS LMVTSISARD LGVIPSPDGR RSMMKLAQRM INNFCSSISA  480
SSSHRWTALS GLNDDGVRVT THKSTDPGQP NGVVLSAATS LWLPVSPQNI FNFFRDERTR  540
PQWDVLSSGN AVQEVAHIAN GSHPGNCISL LRAFNSSQNN MLILQESCTD SSGSLVVYAP  600
IDVTAANIAM SGEDPSYIAL LPSGFTILPD GRPPDHNLIG GPSTSSSSSS GSSGSLITVA  660
FQILVSSLPS AKLNLESVTT VNNLISTTVQ QIKAALNCSG A*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006849468.10.0PREDICTED: homeobox-leucine zipper protein ROC8 isoform X1
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLW1PT680.0W1PT68_AMBTC; Uncharacterized protein
STRINGVIT_17s0053g00780.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]